The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 2

Every grade prints starting on a new page. No answers are included.

Habakkuk 2 · Preschool

God's Glory Fills the Earth

Name Date

Color the waters. God's glory will fill the whole earth like water fills the sea!

Can you find these in the picture? Circle each one!

Bible Verse

“For the earth will be filled with the knowledge of Yahweh’s glory, as the waters cover the sea.”

Habakkuk 2:14 (WEB)

Prayer

Thank You, God, for making me!

Take It Home

Read the verse aloud. Say: The sea is full of water. One day the whole earth will know how great God is!

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Habakkuk 2 · Kindergarten

Write It Down

Name Date

Trace the Words

Trace each word with your pencil.

WRITE
WAIT
SEA
GLORY
Yahweh answered me, “Write the vision, and make it plain on tablets, that he who runs may read it.

Habakkuk 2:2 (WEB)

Match the Pictures

Draw a line from each word to its picture.

WRITE
WAIT
SEA
GLORY

Mini Maze

Help find the way through the maze.

Draw It

Draw Habakkuk on the watchtower.

Prayer

Dear God, thank You for keeping your promises. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you calm down when you feel upset?
  • How can you remember something God told you?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Habakkuk 2 · Grade 1

Wait for It

Name Date

Trace the Words

Trace the words and the verse.

VISION
FAITH
WAIT
SEA
But Yahweh is in his holy temple. Let all the earth be silent before him!”

Habakkuk 2:20 (WEB)

Match the Pictures

Draw a line from each sentence to its picture.

Habakkuk stands at his watch.
Write it on tablets.
Live by faith.
Waters cover the sea.
God is in his temple.

Wait for It

Write the number 1 to 4 in each circle to show the right order.

But Yahweh is in his holy temple

Write the vision, and make it plain on tablets

For the earth will be filled with the knowledge of Yahweh’s glory, as the waters cover the sea

I will stand at my watch and set myself on the ramparts

Draw Habakkuk on the watchtower.

Memory Verse

But Yahweh is in his holy temple. Let all the earth be silent before him!”

Habakkuk 2:20 (WEB)

Prayer

Dear God, thank You for keeping your promises. Help me . Amen.

Take It Home

For families: talk about these together.

  • What are you waiting for God to do?
  • How can you trust God today?
  • What would you like to say to God about this chapter?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Habakkuk 2 · Grade 2

Wait for God

Name Date

Read the Story

Habakkuk stood on a high wall. He waited for God to talk. God told Habakkuk to write the vision plainly. Make it plain.

God said, wait for it. It will come. God's people live by trusting him. One day the whole earth will know God. It will be full like the sea is full of water. God is in his holy temple.

Memory Verse

“For the earth will be filled with the knowledge of Yahweh’s glory, as the waters cover the sea.”

Habakkuk 2:14 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. Where did Habakkuk wait?

    On a high wallBy trusting himYes

  2. What did God say to do?

    Knowing GodWrite it downBy trusting him

  3. Will God's plan come?

    YesBy trusting himOn a high wall

  4. How do God's people live?

    On a high wallBy trusting himKnowing God

  5. What will the earth be full of?

    Write it downKnowing GodOn a high wall

Word Search

Find and circle each word. Words go across and down.

BFDTYWTWWWCABCAHACPMEIKIVTTWBDFTTIERLAUGEHSRTAETYBOISRGUHCMOOPDPRCOHWNLEWRITEMPLE
  • VISION
  • TEMPLE
  • WATERS
  • WATCH
  • WRITE
  • FAITH
  • WAIT

Prayer

Dear God, thank You for keeping your promises. Help me . Amen.

Take It Home

For families: talk about these together.

  • Why is it important to remember what God has said?
  • What does it mean to wait for God?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Habakkuk 2 · Grade 3

Wait for It

Name Date

Read the Story

Habakkuk stood at his watch to hear what God would say. Yahweh told him to write the vision plainly on tablets.

God said the vision is for the appointed time. Though it takes time, wait for it. It will surely come. The proud person is puffed up, but the righteous will live by faith.

God warned people who were proud and greedy. He also gave a promise. The earth will be filled with the knowledge of his glory, as the waters cover the sea. Yahweh is in his holy temple. Let all the earth be silent before him!

Memory Verse

“For the earth will be filled with the knowledge of Yahweh’s glory, as the waters cover the sea.”

Habakkuk 2:14 (WEB)

Answer the Questions

  1. Where did Habakkuk stand?

  2. Where should the vision be written?

  3. What should Habakkuk do if it takes time?

  4. How will the righteous live?

  5. What will fill the earth?

Wait for It

Write what happened in each box.

1
2
3
4

Word Search

Find each word. Words go across, down, and diagonally.

SCOTVOGSBETFYICDWSHETFSIRRPDMGAIMGINDPMIOWWTOJLGTNPAEVWETHDNTJKWATERSCWGWAITKJHSD
  • VISION
  • TEMPLE
  • WATERS
  • WATCH
  • WRITE
  • FAITH
  • WAIT

Prayer

Dear God, thank You for keeping your promises. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you help others learn about God?
  • Where is Yahweh?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Habakkuk 2 · Grade 4

The Righteous Live by Faith

Name Date

Read and Think

Habakkuk decides to wait for God's reply. He says he will stand at his watch and set himself on the ramparts, like a guard on a city wall. Yahweh answers, write the vision, and make it plain on tablets, that he who runs may read it. The vision is for the appointed time. Though it takes time, wait for it, because it will surely come.

Then God contrasts two kinds of people. The proud person's soul is puffed up and not upright, but the righteous will live by his faith. In the New Testament, Paul quotes this line in Romans 1:17 and Galatians 3:11.

God pronounces woes on those who get rich by taking from others, who build a town with blood, and who trust idols that cannot speak. But in the middle comes hope: the earth will be filled with the knowledge of Yahweh's glory, as the waters cover the sea. The chapter ends, Yahweh is in his holy temple. Let all the earth be silent before him!

Show What You Know

  1. How does Habakkuk wait for God's answer?

  2. Why should the vision be written plainly?

  3. Where does the New Testament quote verse 4?

  4. What should all the earth do before Yahweh?

Word Bank Fill-In

Use the word bank to fill in each blank.

Godvisionwaitwritewatch
  1. He says he will stand at his and set himself on the ramparts, like a guard on a city wall.
  2. Yahweh answers, the vision, and make it plain on tablets, that he who runs may read it.
  3. The is for the appointed time.
  4. Though it takes time, for it, because it will surely come.
  5. Then contrasts two kinds of people.

Think About It

  1. God told Habakkuk to wait for the vision. What is hard about waiting for God?

  2. The righteous live by faith. What does trusting God look like in your everyday life?

Memory Verse

“Behold, his soul is puffed up. It is not upright in him, but the righteous will live by his faith.”

Habakkuk 2:4 (WEB)

Copy It

Prayer

Dear God, thank You for keeping your promises. Help me . Amen.

Take It Home

For families: talk about these together.

  • What is something you are waiting for right now?
  • How can you show trust in God at home this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Habakkuk 2 · Grade 5

Let All the Earth Be Silent

Name Date

Read and Think

After his second complaint, Habakkuk takes the posture of a watchman. He says, I will stand at my watch and set myself on the ramparts, and will look out to see what he will say to me. Yahweh answers with instructions: write the vision, and make it plain on tablets, that he who runs may read it. The vision is for the appointed time; though it takes time, wait for it, because it will surely come.

Verse 4 is the heart of God's answer. Behold, his soul is puffed up. It is not upright in him, but the righteous will live by his faith. The proud trust themselves, but the righteous live by trusting God. In the New Testament, Paul builds on this verse in Romans 1:17 and Galatians 3:11, and Hebrews 10:38 quotes it to encourage believers to endure.

The rest of the chapter is a taunt song of five woes against the proud oppressor: woe to him who increases what is not his, who gets evil gain, who builds a town with blood, who shames his neighbor, and who says to wood, Awake! Each woe shows that evil eventually turns back on itself. Two verses rise above the woes: the earth will be filled with the knowledge of Yahweh's glory, as the waters cover the sea, and Yahweh is in his holy temple; let all the earth be silent before him. Idols are mute, but the living God reigns.

Show What You Know

  1. What does the watchman image show about Habakkuk?

  2. What two kinds of people does verse 4 contrast?

  3. Name two New Testament books that use verse 4.

  4. How does verse 20 contrast with the idols in verses 18-19?

Crossword

41253

Across

  1. I will stand at my ____ and set myself on the ramparts.
  2. But Yahweh is in his holy ____.
  3. For the ____ is yet for the appointed time.

Down

  1. But the righteous will live by his ____.
  2. As the ____ cover the sea.

Think About It

  1. Habakkuk was told the answer would come, but not right away. How can you keep trusting God while you wait?

  2. Verse 14 promises the whole earth will know God's glory. How can your life help someone know God better?

Memory Verse

“Behold, his soul is puffed up. It is not upright in him, but the righteous will live by his faith.”

Habakkuk 2:4 (WEB)

Copy It

Prayer

Dear God, thank You for keeping your promises. Help me . Amen.

Take It Home

For families: talk about these together.

  • What do you sometimes love more than God, and how can you put him first?
  • Who could you encourage to keep trusting God this week?
  • What is one way you could live out this chapter this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.