The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 3

Every grade prints starting on a new page. No answers are included.

2 Corinthians 3 · Preschool

A Letter From Jesus

Name Date

Color the letter and the heart. God writes His love on our hearts!

Can you find these in the picture? Circle each one!

Bible Verse

“Now the Lord is the Spirit; and where the Spirit of the Lord is, there is liberty.”

2 Corinthians 3:17 (WEB)

Prayer

Thank You, God, for making me!

Take It Home

Read the verse aloud. Say: Paul said the people at church were like a letter from Jesus. God writes His love on our hearts.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

2 Corinthians 3 · Kindergarten

God's Letter

Name Date

Trace the Words

Trace each word with your pencil.

LETTER
HEART
FREE
SHINE
Now the Lord is the Spirit; and where the Spirit of the Lord is, there is liberty.

2 Corinthians 3:17 (WEB)

Match the Pictures

Draw a line from each word to its picture.

LETTER
HEART
FREE
SHINE

Mini Maze

Help find the way through the maze.

Draw It

Draw a letter written on a heart.

Prayer

Dear God, thank You for writing Your word on my heart. Help me . Amen.

Take It Home

For families: talk about these together.

  • Who writes love on our hearts?
  • How can you shine for Jesus?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

2 Corinthians 3 · Grade 1

From Glory to Glory

Name Date

Trace the Words

Trace the words and the verse.

LETTER
STONE
SPIRIT
VEIL
GLORY
Now the Lord is the Spirit; and where the Spirit of the Lord is, there is liberty.

2 Corinthians 3:17 (WEB)

Match the Pictures

Draw a line from each sentence to its picture.

The church is Paul's letter.
The law was on stone.
The Spirit writes on hearts.
The veil is taken away.
Shine more and more.

From Glory to Glory

Write the number 1 to 4 in each circle to show the right order.

Now the Lord is the Spirit; and where the Spirit of the Lord is, there is liberty

Are we beginning again to commend ourselves

For the letter kills, but the Spirit gives life

But whenever someone turns to the Lord, the veil is taken away

Draw a letter written on a heart.

Memory Verse

“Now the Lord is the Spirit; and where the Spirit of the Lord is, there is liberty.”

2 Corinthians 3:17 (WEB)

Prayer

Dear God, thank You for writing Your word on my heart. Help me . Amen.

Take It Home

For families: talk about these together.

  • What was the law written on?
  • What does the Spirit do?
  • What would you like to say to God about this chapter?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

2 Corinthians 3 · Grade 2

A Letter on the Heart

Name Date

Read the Story

Paul said the church was like a letter. It was not written with ink. God's Spirit wrote it on their hearts.

Long ago, God gave Moses His law on stone. Moses' face shined. He put a cloth over his face.

Paul said that when people turn to Jesus, the cloth is taken away. They can see God's glory. God's Spirit makes them more like Jesus.

Memory Verse

“But we all, with unveiled face seeing the glory of the Lord as in a mirror, are transformed into the same image from glory to glory, even as from the Lord, the Spirit.”

2 Corinthians 3:18 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. What was the church like?

    A clothA letterGod's Spirit

  2. Who wrote on their hearts?

    StoneGod's SpiritA cloth

  3. What was God's law written on?

    God's SpiritStoneA cloth

  4. What did Moses put over his face?

    StoneA clothA letter

  5. Who makes people more like Jesus?

    God's SpiritStoneA cloth

Word Search

Find and circle each word. Words go across and down.

OBLOBETYVCNFEIPACEOVEFTPBHIVHGEYTLMLEECLDVEJANARGOGTRAARRLLRSLNNTYRKPYFITSVOREADS
  • COVENANT
  • TABLETS
  • LETTER
  • HEARTS
  • GLORY
  • VEIL
  • READ
  • NEED

Prayer

Dear God, thank You for writing Your word on my heart. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can others see God's love in you?
  • How is God changing you?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

2 Corinthians 3 · Grade 3

Unveiled Faces

Name Date

Read the Story

Paul did not need a letter to prove he was a true apostle. The believers in Corinth were his letter. They were written not with ink, but with the Spirit of the living God on their hearts.

When God gave the law to Moses on stone tablets, Moses' face shined with God's glory. He covered his face with a veil, and the glory faded. Paul said the new way of the Spirit has even greater glory.

Paul said, But whenever someone turns to the Lord, the veil is taken away. Paul said that where the Spirit of the Lord is, there is liberty. God's people are being changed to be more like Jesus.

Memory Verse

“But we all, with unveiled face seeing the glory of the Lord as in a mirror, are transformed into the same image from glory to glory, even as from the Lord, the Spirit.”

2 Corinthians 3:18 (WEB)

Answer the Questions

  1. What were the believers in Corinth for Paul?

  2. What happened to the glory on Moses' face?

  3. What happens when someone turns to the Lord?

  4. What is there where the Spirit of the Lord is?

From Glory to Glory

Write what happened in each box.

1
2
3
4

Word Search

Find each word. Words go across, down, and diagonally.

UJNHBNACCCBTLEPEFBROGAEASEREJVLBTRADACVEOLTTODCEINREESFPIHPAYTRVHLFDLNWSWNRYTIKTJ
  • COVENANT
  • TABLETS
  • LETTER
  • HEARTS
  • GLORY
  • VEIL
  • READ
  • NEED

Prayer

Dear God, thank You for writing Your word on my heart. Help me . Amen.

Take It Home

For families: talk about these together.

  • How does the Spirit change people?
  • How can you use your freedom in Christ to do good?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

2 Corinthians 3 · Grade 4

Written by the Spirit

Name Date

Read and Think

Some teachers came to Corinth with letters of recommendation. Paul says he needs none. The Corinthian believers are his letter, known and read by everyone. They are written not with ink but with the Spirit of the living God, not on tablets of stone but on human hearts.

Paul compares two covenants. The old covenant came with glory. When Moses brought the law, his face shone so brightly that the people could not look at him, and he wore a veil while the glory faded. If that covenant came with glory, the new covenant of the Spirit has even more glory, because it brings righteousness and it lasts.

Paul says that a veil still covers the hearts of many who read the law without Christ. But whenever someone turns to the Lord, the veil is taken away. The Lord is the Spirit, and where the Spirit is, there is liberty. Believers look at the Lord's glory and are being changed into His image from glory to glory.

Show What You Know

  1. Where is Paul's letter written?

  2. Why did Moses wear a veil?

  3. Why does the new covenant have more glory?

  4. What happens to believers who look at the Lord's glory?

Word Bank Fill-In

Use the word bank to fill in each blank.

veilheartscovenantgloryletter
  1. The Corinthian believers are his , known and read by everyone.
  2. They are written not with ink but with the Spirit of the living God, not on tablets of stone but on human .
  3. The old covenant came with .
  4. When Moses brought the law, his face shone so brightly that the people could not look at him, and he wore a while the glory faded.
  5. If that came with glory, the new covenant of the Spirit has even more glory, because it brings righteousness and it lasts.

Think About It

  1. Paul says the believers' changed lives were his letter. What might people read about Jesus by watching your life?

  2. Believers are being changed from glory to glory. In what ways have you seen God change you over time?

Memory Verse

“But we all, with unveiled face seeing the glory of the Lord as in a mirror, are transformed into the same image from glory to glory, even as from the Lord, the Spirit.”

2 Corinthians 3:18 (WEB)

Copy It

Prayer

Dear God, thank You for writing Your word on my heart. Help me . Amen.

Take It Home

For families: talk about these together.

  • What can people learn about Jesus from your life?
  • How has God changed you over time?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

2 Corinthians 3 · Grade 5

The Ministry of the Spirit

Name Date

Read and Think

Paul's opponents carried letters of recommendation. Paul replies that the Corinthian church itself is his letter, written on hearts and read by all. The image recalls the prophets' promise that God would one day write His law on hearts and replace hearts of stone with hearts of flesh. Paul's sufficiency comes not from himself but from God, who made him a minister of a new covenant, not of the letter but of the Spirit.

He then contrasts the two covenants with care. The old covenant, engraved on stone, came with such glory that Israel could not gaze at Moses' face. Yet that glory was fading, and the covenant brought condemnation because it exposed sin without giving power to obey. The ministry of the Spirit brings righteousness and life, and its glory is permanent and surpassing.

Paul reads Exodus 34 typologically. Moses veiled his face so Israel would not see the fading glory. A similar veil lies over hearts when the old covenant is read apart from Christ. Only in Christ is it removed. Whenever a person turns to the Lord, the veil is taken away. The Lord is the Spirit, and where the Spirit of the Lord is, there is liberty. All believers, with unveiled faces, behold the Lord's glory as in a mirror and are transformed into the same image from one degree of glory to another.

Show What You Know

  1. What prophetic promise does the image of a letter on hearts recall?

  2. Why did the old covenant bring condemnation?

  3. When is the veil over hearts removed?

  4. How are believers transformed?

Crossword

42351

Across

  1. For if the service of condemnation has ____
  2. Not in ____ of stone
  3. A ____ lies on their heart

Down

  1. You are our ____
  2. Or do we ____

Think About It

  1. Paul says his sufficiency comes from God, not from himself. How does that free a person from both pride and fear in serving God?

  2. Transformation happens as believers behold the Lord's glory. What practices help you keep your eyes on Christ?

Memory Verse

“But we all, with unveiled face seeing the glory of the Lord as in a mirror, are transformed into the same image from glory to glory, even as from the Lord, the Spirit.”

2 Corinthians 3:18 (WEB)

Copy It

Prayer

Dear God, thank You for writing Your word on my heart. Help me . Amen.

Take It Home

For families: talk about these together.

  • Where does true sufficiency come from?
  • What helps you keep your eyes on Christ?
  • What is one way you could live out this chapter this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.