The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 25

Every grade prints starting on a new page. No answers are included.

2 Chronicles 25 · Preschool

God Can Give More

Name Date

Color the coins. God can give us much more than we lose.

Can you find these in the picture? Circle each one!

Bible Verse

Amaziah said to the man of God, “But what shall we do for the hundred talents which I have given to the army of Israel?” The man of God answered, “Yahweh is able to give you much more than this.”

2 Chronicles 25:9 (WEB)

Prayer

Thank You, God, for making me!

Take It Home

Read the verse aloud. Say: The king was worried about losing money. God's helper said, God can give you much more. We can trust God.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

2 Chronicles 25 · Kindergarten

Trust

Name Date

Trace the Words

Trace each word with your pencil.

TRUST
MORE
OBEY
GOD
He did that which was right in Yahweh’s eyes, but not with a perfect heart.

2 Chronicles 25:2 (WEB)

Match the Pictures

Draw a line from each word to its picture.

MONEY
KING
PROPHET
HEART

Mini Maze

Help find the way through the maze.

Draw It

Draw a whole heart.

Prayer

Dear God, thank You for giving me more than I need. Help me . Amen.

Take It Home

For families: talk about these together.

  • What does it mean to trust God?
  • What can God give us?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

2 Chronicles 25 · Grade 1

A Half Heart

Name Date

Trace the Words

Trace the words and the verse.

HEART
OBEY
MORE
PROUD
He did that which was right in Yahweh’s eyes, but not with a perfect heart.

2 Chronicles 25:2 (WEB)

Match the Pictures

Draw a line from each sentence to its picture.

Amaziah was king.
He paid for soldiers.
A prophet said, Send them home.
God can give much more.
Later he got proud.

Not with a Perfect Heart

Write the number 1 to 4 in each circle to show the right order.

Why have you sought after the gods of the people

Yahweh is able to give you much more than this

Joash king of Israel sent to Amaziah king of Judah

He did that which was right in Yahweh’s eyes, but not with a perfect heart

Draw a whole heart.

Memory Verse

“He did that which was right in Yahweh’s eyes, but not with a perfect heart.”

2 Chronicles 25:2 (WEB)

Prayer

Dear God, thank You for giving me more than I need. Help me . Amen.

Take It Home

For families: talk about these together.

  • What did the man of God say?
  • Did the king obey?
  • What has God given you?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

2 Chronicles 25 · Grade 2

A Half Heart

Name Date

Read the Story

Amaziah was king. He did good things. But he did not love God with all his heart.

He paid soldiers from Israel to help him. A man of God said, Send them home. God is not with them. The king asked about his money. The man said God could give him much more.

The king obeyed. God helped him win. But later he bowed to fake gods. He did not listen to God's helper. He stopped listening to God.

Memory Verse

“He did that which was right in Yahweh’s eyes, but not with a perfect heart.”

2 Chronicles 25:2 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. Did Amaziah love God with all his heart?

    NoHe bowed to fake godsMuch more

  2. Who did he pay to help him?

    NoSoldiers from IsraelMuch more

  3. What did the man of God say?

    Much moreSend them homeSoldiers from Israel

  4. What can God give?

    Much moreNoHe bowed to fake gods

  5. What did the king do later?

Word Search

Find and circle each word. Words go across and down.

VWAJKIOYJIHMEKSRAOLEARIRWHAIAZUNARWSMRISGEKEHSTAALLYHRRFHLCPNKJFWPEWMPPFVHLMJUDAH
  • JERUSALEM
  • AMAZIAH
  • ISRAEL
  • YAHWEH
  • JUDAH
  • JOASH
  • HEART
  • KING

Prayer

Dear God, thank You for giving me more than I need. Help me . Amen.

Take It Home

For families: talk about these together.

  • When is it hard for you to obey God?
  • How can you love God with your whole heart?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

2 Chronicles 25 · Grade 3

Yahweh Is Able

Name Date

Read the Story

Amaziah was twenty-five when he began to reign. He did right in Yahweh's eyes, but not with a perfect heart. He gathered Judah's army and hired soldiers from Israel for a hundred talents of silver.

A man of God came to him. He told the king not to let Israel's army go with him, for Yahweh was not with Israel. Amaziah asked about the hundred talents. The man of God answered, Yahweh is able to give you much more than this. So Amaziah sent the soldiers home.

Amaziah won against Edom. But he brought back the gods of Edom and bowed down to them. A prophet warned him, and he told the prophet to stop. He stopped listening to God.

Memory Verse

Amaziah said to the man of God, “But what shall we do for the hundred talents which I have given to the army of Israel?” The man of God answered, “Yahweh is able to give you much more than this.”

2 Chronicles 25:9 (WEB)

Answer the Questions

  1. How did Amaziah do right?

  2. How much did he pay the soldiers from Israel?

  3. What did the man of God say Yahweh is able to do?

  4. What did Amaziah bring back from Edom?

  5. What did Amaziah stop doing?

Not with a Perfect Heart

Write what happened in each box.

1
2
3
4

Prayer

Dear God, thank You for giving me more than I need. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you obey God when it is hard?
  • What happens when we get proud?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

2 Chronicles 25 · Grade 4

Much More Than This

Name Date

Read and Think

Amaziah began well. He did right in Yahweh's eyes, though not with a perfect heart. He obeyed the law of Moses that children should not die for their fathers' sins. Then he prepared for war and hired a hundred thousand soldiers from Israel for a hundred talents of silver.

A man of God warned him that Yahweh was not with Israel. Amaziah's concern was the money. The prophet answered, Yahweh is able to give you much more than this. Amaziah obeyed, sent the soldiers home, and took courage. Judah won the battle against Edom.

Then came a strange turn. Amaziah brought home the gods of the very people he had defeated and worshiped them. God sent a prophet to ask why he would seek gods that could not save their own people. Amaziah silenced him. Proud of his win, he challenged Israel and was defeated. Jerusalem's wall was broken, and treasure was taken.

Show What You Know

  1. What law of Moses did Amaziah obey?

  2. What was Amaziah's concern?

  3. What did the prophet say Yahweh is able to do?

  4. What did Amaziah do after defeating Edom?

  5. What happened when he challenged Israel?

Word Bank Fill-In

Use the word bank to fill in each blank.

JudahAmaziahIsraelGodYahweh
  1. began well.
  2. Then he prepared for war and hired a hundred thousand soldiers from for a hundred talents of silver.
  3. A man of God warned him that was not with Israel.
  4. won the battle against Edom.
  5. sent a prophet to ask why he would seek gods that could not save their own people.

Think About It

  1. Amaziah was worried about losing money by obeying God. When is obeying God costly for you?

  2. Amaziah served God, but not with a perfect heart. What does it mean to follow God with your whole heart?

Memory Verse

Amaziah said to the man of God, “But what shall we do for the hundred talents which I have given to the army of Israel?” The man of God answered, “Yahweh is able to give you much more than this.”

2 Chronicles 25:9 (WEB)

Copy It

Prayer

Dear God, thank You for giving me more than I need. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you keep from copying the wrong ways of others?
  • When is obeying God costly for you?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

2 Chronicles 25 · Grade 5

A Divided Heart

Name Date

Read and Think

Verse 2 summarizes Amaziah: he did right, but not with a perfect heart. His obedience was real but partial. He followed the law of Moses in punishing only the guilty, not their children. Yet his heart was never fully given to God, and the rest of his story reveals that.

The test came over money. He had paid a hundred talents for Israelite soldiers, and God's prophet told him to send them away. The prophet's answer still speaks: Yahweh is able to give much more than this. Amaziah obeyed, and Judah won. Trusting God sometimes means letting go of money already spent.

Victory exposed his divided heart. He worshiped Edom's defeated gods, refused the prophet, and was proud. He provoked Joash of Israel, who warned him with a parable about a thistle and a cedar. Amaziah would not listen, and Judah fell. In the New Testament, Paul writes that God is able to do exceedingly abundantly above all that we ask or think (Ephesians 3:20).

Show What You Know

  1. How does verse 2 summarize Amaziah?

  2. What was the test about?

  3. What does trusting God sometimes mean?

  4. What parable did Joash tell?

  5. What does Paul write in Ephesians 3:20?

Crossword

4123

Across

  1. ____ king of Israel sent to Amaziah king of Judah
  2. ____ was twenty-five years old when he began to reign

Down

  1. Don’t let the army of ____ go with you
  2. Even all ____ and Benjamin
  3. The ____ said to him

Think About It

  1. Amaziah's victory led to pride. How can success pull your heart away from God?

  2. Yahweh is able to give you much more than this. What are you holding onto that you need to trust God with?

Memory Verse

“He did that which was right in Yahweh’s eyes, but not with a perfect heart.”

2 Chronicles 25:2 (WEB)

Copy It

Prayer

Dear God, thank You for giving me more than I need. Help me . Amen.

Take It Home

For families: talk about these together.

  • How does Ephesians 3:20 in the New Testament connect to this chapter?
  • How can success pull your heart away from God?
  • What is one way you could live out this chapter this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.