The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 25

Prints on letter paper in black and white. No answers are printed on the student sheet.

2 Chronicles 25 · Grade 2

A Half Heart

Name Date

Read the Story

Amaziah was king. He did good things. But he did not love God with all his heart.

He paid soldiers from Israel to help him. A man of God said, Send them home. God is not with them. The king asked about his money. The man said God could give him much more.

The king obeyed. God helped him win. But later he bowed to fake gods. He did not listen to God's helper. He stopped listening to God.

Memory Verse

“He did that which was right in Yahweh’s eyes, but not with a perfect heart.”

2 Chronicles 25:2 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. Did Amaziah love God with all his heart?

    NoHe bowed to fake godsMuch more

  2. Who did he pay to help him?

    NoSoldiers from IsraelMuch more

  3. What did the man of God say?

    Much moreSend them homeSoldiers from Israel

  4. What can God give?

    Much moreNoHe bowed to fake gods

  5. What did the king do later?

Word Search

Find and circle each word. Words go across and down.

VWAJKIOYJIHMEKSRAOLEARIRWHAIAZUNARWSMRISGEKEHSTAALLYHRRFHLCPNKJFWPEWMPPFVHLMJUDAH
  • JERUSALEM
  • AMAZIAH
  • ISRAEL
  • YAHWEH
  • JUDAH
  • JOASH
  • HEART
  • KING

Prayer

Dear God, thank You for giving me more than I need. Help me . Amen.

Take It Home

For families: talk about these together.

  • When is it hard for you to obey God?
  • How can you love God with your whole heart?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.